PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G408800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 572aa    MW: 63547.4 Da    PI: 4.6172
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G408800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.51e-1302025712374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+a+s+ +  +aqa+++ l++++s +gdp qR+aay++e+Laar++ s++++ykal++++ +   s  +l+a+++++e++P+++
  Sevir.5G408800.2.p 202 KQLLFDCATALSEYNIDEAQAIISDLRQMVSIQGDPSQRIAAYLVEGLAARIVASGNGIYKALTCKDPP---SLYQLSAMQILFEICPCFR 289
                         589*****************************************************************9...999**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +++++aN aIlea +geer+HiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+++Ae +gv+fef++ 
  Sevir.5G408800.2.p 290 LGFMAANYAILEACKGEERLHIIDFDINQGSQYITLIQFLKNNSNKPRHLRITGVDDPETVqrPIGGLKVIGQRLEQLAEDCGVSFEFRA- 379
                         ***********************************************************99878899***********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         v  +l d+++ +L+++pgEalaVn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++Fl+rf e  +yy alfdsl+
  Sevir.5G408800.2.p 380 VGANLGDVTPAMLDCRPGEALAVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFLTRFREVYDYYYALFDSLD 470
                         799**************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF+p p+++++ + +k++l+ + ++ y+ ee++g l +gW 
  Sevir.5G408800.2.p 471 ATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFNSNVISGIKSILKSYCDR-YKFEEDHGGLHFGWG 560
                         *************************************************************************66.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         +++L++ SaW+
  Sevir.5G408800.2.p 561 EKTLIVSSAWQ 571
                         **********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.778175552IPR005202Transcription factor GRAS
PfamPF035143.6E-128202571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MSFVRRADPS TAYTDNLYIH KFAAPSSNFA AQRFSSDTQL FRYGPEPYNG EYGHMGFTGS  60
SSAVFQNSFC SQQASLTPYC VTADERSPSV ADTQSNSCSD AAKESPVVSN VSQHNSQSVS  120
DTQSSEIEVQ FDEDEIRLKL QELEHALLDD GDDILFEISQ AGSINDEWAD PMKNVLLPNS  180
PKESESSISC AVSNSRTART PKQLLFDCAT ALSEYNIDEA QAIISDLRQM VSIQGDPSQR  240
IAAYLVEGLA ARIVASGNGI YKALTCKDPP SLYQLSAMQI LFEICPCFRL GFMAANYAIL  300
EACKGEERLH IIDFDINQGS QYITLIQFLK NNSNKPRHLR ITGVDDPETV QRPIGGLKVI  360
GQRLEQLAED CGVSFEFRAV GANLGDVTPA MLDCRPGEAL AVNFAFQLHH LPDESVSIMN  420
ERDQLLRMVK GLQPKLVTLV EQDANTNTAP FLTRFREVYD YYYALFDSLD ATLPRESPDR  480
MNVERQCLAR EIVNILACEG PDRVERYEVA GKWRARMTMA GFTPCPFNSN VISGIKSILK  540
SYCDRYKFEE DHGGLHFGWG EKTLIVSSAW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-552035716375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970786.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK3XG130.0K3XG13_SETIT; Uncharacterized protein
STRINGSi000832m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1